neurotrophic signaling raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-08-01. Anything still debated is marked as such rather than presented as settled.
Semax is a synthetic heptapeptide developed in the Soviet Union during the 1980s by researchers at the Institute of Molecular Genetics in Moscow. It was designed as a truncated analog of adrenocorticotropic hormone, retaining only the fragment spanning residues four through ten. Investigators sought a peptide that would preserve the cognitive effects associated with ACTH while eliminating the hormonal stimulation of the adrenal cortex. The compound entered clinical use in Russia during the following decade.
Russian regulatory authorities approved the peptide for nasal administration, and it remains listed in the national pharmacopoeia under several trade names. Documented indications include acute ischemic stroke, transient ischemic attacks, traumatic brain injury, and certain ophthalmological and neurological conditions. Physicians also prescribe it for cognitive complaints in older patients, although the evidence base for that use is thinner. Outside Russia and a few neighboring states, the substance is not an approved medicine and is sold instead as a research chemical.
Proposed mechanisms center on neurotrophic signaling rather than on classical melanocortin receptor activation. Rodent experiments have reported shifts in the expression of brain-derived neurotrophic factor and nerve growth factor after administration, together with changes in the associated receptor systems. Several authors argue that the peptide acts largely through its degradation products and their interaction with peptidergic pathways, but this remains a hypothesis rather than a settled finding. No single molecular target has been identified in a way that the field broadly accepts.
Published research covers ischemic stroke, traumatic brain injury, cognitive impairment, optic nerve conditions and attention-related measures. Much of the human evidence comes from small trials conducted in one country, which limits how far the results generalize. Animal models supply the larger share of the data, and effects seen in rodents do not transfer automatically to people. Reviews have noted that methodological reporting is often incomplete, making it difficult to pool results or compare treatment schedules across studies.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic heptapeptide | Analog of an ACTH fragment |
| Amino acid length | Seven residues | Met-Glu-His-Phe-Pro-Gly-Pro |
| Origin | Moscow, 1980s | Institute of Molecular Genetics |
| Approved regions | Russia and some neighboring states | Not cleared in Western markets |
| Common trade names | Multiple national brands | Sold as a nasal formulation |
Clinical evidence consists largely of small trials with modest sample sizes, often without independent replication. Reported endpoints include cognitive scores, recovery after stroke, and visual function, but study designs vary widely and few trials meet contemporary reporting standards. Systematic reviewers have noted a high risk of bias in several of these reports. No large multicenter trial conducted outside Russia has been published. The compound is therefore best described as investigational in most jurisdictions, with its clinical role still unresolved.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. Its chain combines the first seven residues of corticotropin with a C-terminal proline-glycine-proline extension, a modification intended to slow enzymatic breakdown. The free peptide has a molecular mass near 813.9 daltons. It belongs to the class of ACTH-derived fragments studied for central nervous system activity rather than for adrenal steroid stimulation. This structural relationship to a natural hormone fragment is the usual starting point for describing the compound in the literature.
Once dissolved, the peptide is considerably less stable than the solid. Aqueous solutions are usually prepared at neutral to slightly acidic pH, filtered, and divided into single-use aliquots before freezing. Repeated freeze-thaw cycles are a common cause of avoidable loss and are best prevented by never refreezing a thawed aliquot. Adsorption to plastic and glass surfaces can lower the measured concentration of dilute solutions, particularly below roughly 0.1 mg/mL. Buffer choice, salt content, and container material all influence how much peptide remains detectable after storage.
Identity and purity are established with standard peptide methods. Reversed-phase HPLC with ultraviolet detection near 214 nm resolves the parent peak from deletion and truncation byproducts, and reports typically quote a main-peak percentage. Mass spectrometry by electrospray or MALDI-TOF confirms the expected molecular mass, while amino acid analysis or peptide mapping can verify composition when the sequence itself is in question. A certificate of analysis that pairs a chromatogram with a mass spectrum is more informative than a purity figure alone. Counter-ion content and residual solvents are separate specifications and are frequently omitted.
He called the bill "crony capitalism" and set several conditions for acceptance of the bill: "Companies must agree to issue warrants or equity stakes to the federal government; they must commit to not buying back their own stock, outsourcing American jobs overseas or repealing existing collective bargaining agreements; and they must remain neutral in any union organizing efforts". In April 2023, Sanders endorsed Biden in the 2024 United States presidential election, and after Biden withdrew from the race, Sanders endorsed Harris for president at the Democratic National Convention. Sanders attempted to appeal to pro-Palestinian critics of Harris by saying, "I promise you, after Kamala wins, we will together do everything that we can to change US policy toward Netanyahu", and emphasizing Donald Trump's policies on climate change, minimum wage, and tax cuts for the wealthy.
== Career == Burnham is a professor of Pathology and Immunology, Molecular Microbiology, Pediatrics and Medicine at Washington University. She is the medical director for the clinical microbiology laboratory at Barnes-Jewish Hospital and the program director for the CPEP fellowship at Washington University.
== Distribution == Mealworms most-likely originated in the Mediterranean region, but are now present in many areas of the world as a result of human trade and colonization. The oldest archaeological records of mealworms can be traced to Bronze Age Turkey. Records from the British Isles and northern Europe are from a later date, and mealworms are conspicuously absent from archaeological finds from ancient Egypt.
Sources: en.wikipedia.org
Cytochromes c (cyt c, c-type cytochromes) cytochromes, or heme-containing proteins, that have heme C covalently attached to the peptide backbone via one or two thioether bonds. These bonds are in most cases part of a specific Cys-X-X-Cys-His (CXXCH) binding motif, where X denotes a miscellaneous amino acid. Two thioether bonds of cysteine residues bind to the vinyl sidechains of heme, and the histidine residue coordinates one axial binding site of the heme iron. Less common binding motifs can include a single thioether linkage, a lysine or a methionine instead of the axial histidine or a CXnCH binding motif with n>2. The second axial site of the iron can be coordinated by amino acids of the protein, substrate molecules or water. Cytochromes c possess a wide range of properties and function as electron transfer proteins or catalyse chemical reactions involving redox processes. A prominent member of this family is mitochondrial cytochrome c.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
== House of Este == In 1452 Holy Roman Emperor Frederick III offered the duchy to Borso d'Este, whose family had ruled the city of Modena and nearby Reggio Emilia for centuries. Borso in 1450 had also succeeded his brother as margrave in the adjacent Papal Duchy of Ferrara, where he received the ducal title in 1471. The Este lands on the southern border of the Holy Roman Empire with the Papal States formed a stabilizing buffer state in the interest of both.
Sources: en.wikipedia.org
=== Softmaxxing === "Softmaxxing" is a subset of looksmaxxing that refers to non-invasive and simple practices used to achieve minor improvements to one's appearance. These include skincare, grooming, clothing choices, and general fitness such as weight management and exercise. Additional less conventional practices are also included in the scope of softmaxxing; popular examples include "mewing", which involves suctioning one's tongue to the roof of the mouth with the intention of an improved jaw and facial structure, and "NoFap", where one abstains from masturbation for perceived physical and mental benefits. Such practices come up more often in looksmaxxing discourse due to their niche nature. Practices associated with softmaxxing were previously popularized among men by magazines such as GQ, Esquire, and Men's Health, which share skincare and hairstyle advice.
==== Fibres ==== Fibres found in the extracellular matrix are collagen fibers, elastic fibers, and reticular fibers. Collagen fibres are fixated in intercellular spaces via ground substance, a clear, colorless, and viscous fluid containing glycosaminoglycans and proteoglycans.
Obesity in pets is common in many countries. In the United States, 23–41% of dogs are overweight, and about 5.1% are obese. The rate of obesity in cats was slightly higher at 6.4%. In Australia, the rate of obesity among dogs in a veterinary setting has been found to be 7.6%. The risk of obesity in dogs is related to whether or not their owners are obese; however, there is no similar correlation between cats and their owners.
The scheme might be made far more attractive to the majority of Jews if it held out to them the prospect that when in course of time the Jewish colonists in Palestine grow strong enough to cope with the Arab population they may be allowed to take the management of the internal affairs of Palestine (with the exception of Jerusalem and the holy places) into their own hands. Sykes, having seen the telegram, had discussions with Picot and proposed (making reference to Samuel's memorandum) the creation of an Arab Sultanate under French and British protection, some means of administering the holy places along with the establishment of a company to purchase land for Jewish colonists, who would then become citizens with equal rights to Arabs. Shortly after returning from Petrograd, Sykes briefed Samuel, who then briefed a meeting of Gaster, Weizmann and Sokolow. Gaster recorded in his diary on 16 April 1916: "We are offered French-English condominium in Palest[ine]. Arab Prince to conciliate Arab sentiment and as part of the Constitution a Charter to Zionists for which England would stand guarantee and which would stand by us in every case of friction ... It practically comes to a complete realisation of our Zionist programme.
Sources: en.wikipedia.org
It originated at the Institute of Molecular Genetics in Moscow during the 1980s. The work was carried out by a Russian research group that specialized in peptide neuropharmacology.
It is registered as a medicine in Russia and has been used clinically there for decades. No regulatory agency in Western Europe or North America has approved it for any indication.
Semax corresponds to the four-to-ten fragment of adrenocorticotropic hormone. Because it omits the first three residues, it lacks the adrenal-stimulating action of the full hormone.
The main proposal is modulation of neurotrophic factors such as brain-derived neurotrophic factor, supported largely by animal experiments. Receptor-level targets have not been firmly established. Most reviews describe the mechanism as only partially characterized.